PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P12710_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 231aa    MW: 26364.4 Da    PI: 8.7968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P12710_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.8e-161764148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+ll + v ++G g W+++++  g++R +k+c++rw +yl
  GSMUA_Achr8P12710_001 17 KGPWTAQEDKLLTEHVSLHGDGKWNSVSKLTGLRRNGKSCRLRWVNYL 64
                           79********************************************97 PP

2Myb_DNA-binding482.9e-1570114147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ T++E+ ++ ++++++G++ W+ Iar ++ gRt++++k++w+++
  GSMUA_Achr8P12710_001  70 RGNITPQEEIIIQELHALWGNR-WSNIARSLP-GRTDNEIKNYWRTH 114
                            7999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8321264IPR017930Myb domain
SuperFamilySSF466891.01E-2815111IPR009057Homeodomain-like
SMARTSM007171.4E-131666IPR001005SANT/Myb domain
PfamPF002494.6E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-221870IPR009057Homeodomain-like
CDDcd001671.24E-91964No hitNo description
PROSITE profilePS5129423.86865119IPR017930Myb domain
SMARTSM007174.7E-1569117IPR001005SANT/Myb domain
PfamPF002491.4E-1370114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2371118IPR009057Homeodomain-like
CDDcd001674.37E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDGQLGWGTL DNGEWRKGPW TAQEDKLLTE HVSLHGDGKW NSVSKLTGLR RNGKSCRLRW  60
VNYLRPDLKR GNITPQEEII IQELHALWGN RWSNIARSLP GRTDNEIKNY WRTHFKKSKP  120
SKNVEKARAR FLIRQRQEKQ GQEEQQHLHQ GAQQQQADMR AAMKRAEEAA LAEDMEETTY  180
MYSVSCMLQG GGFSGYSSDG STGDGSWGSL WNLGDVPDDL CAVTALYGER R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-26111811127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411382.11e-173PREDICTED: myb-related protein 340
TrEMBLM0TPX41e-173M0TPX4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P12710_0011e-172(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-63myb domain protein 79